DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and Rnf133

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001037743.1 Gene:Rnf133 / 681395 RGDID:1596695 Length:381 Species:Rattus norvegicus


Alignment Length:291 Identity:94/291 - (32%)
Similarity:145/291 - (49%) Gaps:33/291 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AFLNWSYVEHGNMLCNMEFAQEQARYGEGKVLNVTGRLIHITATDNFSDDYACTP---YIRGTLG 131
            |::|.|:.....||..:   .|...:|...:|.   |:..:..........||.|   :|     
  Rat    40 AYMNISFHVGNRMLSEL---GETGVFGRSSILK---RVAGVVVPPEGKIQNACDPNTSFI----- 93

  Fly   132 APIPDKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYN----DKQVMQLEKMQIKGKTRNIAA 192
              :|...|.||||:.||.|.|.:|:|...:..|.||||||    ..||..:.....:    :|..
  Rat    94 --LPRNKEPWIALIERGGCAFTQKIKVASENGARGVIIYNFPGTGNQVFPMSHQAFE----DIVV 152

  Fly   193 VITYQNIGQDLSLTLDKGYNVTISIIEGRRGVRTISSLNRTSVLFVSISFIVLMIISLVWLIFYY 257
            |:.....|.::...:.||.:||:.:..||:.|..::        ...:||:::...:|.:..||:
  Rat   153 VMIGNVKGMEILHLIRKGVHVTVMVEVGRKHVIWLN--------HYFVSFMIVTTATLAYFTFYH 209

  Fly   258 IQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSDEK-DLDSDCCAICIEAYKPTDTIRILPC 321
            |:|....:.:|::.:.|....|||..::..:..|..||: ..::|.|.||.|||||.:.:|||.|
  Rat   210 IRRLWVARIEDRRWKRLTRELKKAFGQLQVRILKEGDEEVSPNADSCVICFEAYKPNEIVRILTC 274

  Fly   322 KHEFHKNCIDPWLIEHRTCPMCKLDVLKFYG 352
            ||.|||||||||::.|.||||||.|:||..|
  Rat   275 KHFFHKNCIDPWILAHGTCPMCKCDILKALG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 40/150 (27%)
UPF0233 226..>258 CDD:299753 5/31 (16%)
zf-RING_2 301..344 CDD:290367 29/42 (69%)
Rnf133NP_001037743.1 PA_GRAIL_like 43..177 CDD:239037 40/150 (27%)
HRD1 <183..>368 CDD:227568 51/131 (39%)
RING-H2_RNF128_like 254..302 CDD:319716 32/47 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X295
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.