DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and RNF6

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_005968.1 Gene:RNF6 / 6049 HGNCID:10069 Length:685 Species:Homo sapiens


Alignment Length:132 Identity:41/132 - (31%)
Similarity:62/132 - (46%) Gaps:24/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 GRRGVRTISSLNRTSVLFVSISFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMK 284
            |.|.:|..::|..|.         .|.|:.|.        .|..:...|...| :..:||:.|..
Human   567 GGRQLRNPNNLVETG---------TLPILRLA--------HFFLLNESDDDDR-IRGLTKEQIDN 613

  Fly   285 IPTKTGKFSDEKDLDSD---CCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLD 346
            :.|   :..:...:||:   .|::||..|...:.:|.|||.||||.:|||.||.|:.|||:|:..
Human   614 LST---RHYEHNSIDSELGKICSVCISDYVTGNKLRQLPCMHEFHIHCIDRWLSENCTCPICRQP 675

  Fly   347 VL 348
            ||
Human   676 VL 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
UPF0233 226..>258 CDD:299753 5/31 (16%)
zf-RING_2 301..344 CDD:290367 21/45 (47%)
RNF6NP_005968.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..107
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..142
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..273
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..345
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 499..576 3/8 (38%)
Required for polyubiquitination. /evidence=ECO:0000250 607..685 30/74 (41%)
RING-H2_RNF6 630..674 CDD:319587 22/43 (51%)
RING-H2 finger (C3H2C3-type) 632..672 CDD:319587 21/39 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.