DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and RNF150

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_005263207.1 Gene:RNF150 / 57484 HGNCID:23138 Length:460 Species:Homo sapiens


Alignment Length:318 Identity:122/318 - (38%)
Similarity:178/318 - (55%) Gaps:45/318 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AFLNWSYVE-----------HGNMLCNMEFAQEQARYGE-GKVLNVTGRLIHITATDNFSDDYAC 122
            ||:|.:|.|           .|....:.| ..|..|||| ....:..|.::..::.   .|..||
Human    42 AFVNITYAEPAPDPGAGAAGGGGAELHTE-KTECGRYGEHSPKQDARGEVVMASSA---HDRLAC 102

  Fly   123 TPYIRGTLGAPIPDKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYN---------------- 171
            .|..:    ...|.:|:.||||:.:|.||:.:|:::.:.|||:.|:|:|                
Human   103 DPNTK----FAAPTRGKNWIALIPKGNCTYRDKIRNAFLQNASAVVIFNVGSNTNETITMPHAGL 163

  Fly   172 ---DKQVMQLEK---MQIKGKTRNIAAVITYQNIGQDLSLTLDKGYNVTISIIEGRRGVRTISSL 230
               ..|.::|..   ..:.....:|.|::..:..|:::...|::...||:.|..|.|.::  ..:
Human   164 MSSHAQPLKLISPCPYSLSSGVEDIVAIMIPEPKGKEIVSLLERNITVTMYITIGTRNLQ--KYV 226

  Fly   231 NRTSVLFVSISFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSD- 294
            :||||:||||||||||||||.||:|||||||||..|:|:..|.|....||||.|:..:|.|..| 
Human   227 SRTSVVFVSISFIVLMIISLAWLVFYYIQRFRYANARDRNQRRLGDAAKKAISKLQIRTIKKGDK 291

  Fly   295 EKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYG 352
            |.:.|.|.||:|||.|||.|.:|||||:|.|||:|:||||::||||||||:::||..|
Human   292 ETESDFDNCAVCIEGYKPNDVVRILPCRHLFHKSCVDPWLLDHRTCPMCKMNILKALG 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 39/177 (22%)
UPF0233 226..>258 CDD:299753 22/31 (71%)
zf-RING_2 301..344 CDD:290367 30/42 (71%)
RNF150XP_005263207.1 PA_GRAIL_like 45..215 CDD:239037 39/177 (22%)
UPF0233 <229..>254 CDD:299753 21/24 (88%)
zf-RING_2 298..341 CDD:290367 30/42 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145920
Domainoid 1 1.000 90 1.000 Domainoid score I7788
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 218 1.000 Inparanoid score I3586
Isobase 1 0.950 - 0 Normalized mean entropy S3321
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 1 1.000 - - otm41809
orthoMCL 1 0.900 - - OOG6_107948
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3602
SonicParanoid 1 1.000 - - X295
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.