DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and pja2

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_009300150.1 Gene:pja2 / 565118 ZFINID:ZDB-GENE-060526-337 Length:661 Species:Danio rerio


Alignment Length:267 Identity:61/267 - (22%)
Similarity:102/267 - (38%) Gaps:44/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 DNFSDDYACTPYIRGTLGAPIPDKGETWIAL------VRRGRCTFEEKVKHVYQQNAAGVIIYND 172
            :||.:  .|.|.::....:....:|| |.|.      :.:.|||.||.     .:...|:.....
Zfish   371 ENFGE--KCEPSMKADESSSEFSEGE-WSASWTSDSGLDKERCTSEES-----WETLPGIDEPPA 427

  Fly   173 KQVMQLEK-----MQIKGKTRNIAAVITYQNIGQDLSLTLDKG-------YNVTISIIEGRRGVR 225
            .:...||:     :.::.:|......|.:....:|...:.|:.       .:..:.|::|...:.
Zfish   428 SRSSSLEEVPSLNLALEEQTPLEEGEIPWLMYNEDSGSSSDEDPDGVSQFVHPGLFILDGNNNLE 492

  Fly   226 TISSLNR---TSVLFV---SISFIVLMIISLV---WLIFYYIQRFRYMQAKDQQSRNLCSVTKKA 281
            ..||::.   |...|:   ...|.:...||.|   .|:.|.....|..||.:....:|.|:....
Zfish   493 DDSSMSEDLDTEWRFLDEFGDGFGMAQAISYVDHSQLLTYMALEERLAQAMEAALAHLESLAIDV 557

  Fly   282 IMKIPTKTGKFSD---------EKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEH 337
            ....|..|.:..|         |......|||||...|...:...:|||:|.|||.|:..||.:.
Zfish   558 EQAHPPATEQIIDCLPQITMHAENIEQEQCCAICCCEYVKDEIATLLPCRHMFHKLCVTLWLRKS 622

  Fly   338 RTCPMCK 344
            .|||:|:
Zfish   623 GTCPVCR 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 20/120 (17%)
UPF0233 226..>258 CDD:299753 10/40 (25%)
zf-RING_2 301..344 CDD:290367 19/42 (45%)
pja2XP_009300150.1 zf-RING_2 588..629 CDD:290367 18/40 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.