DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and RNF130

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_024301897.1 Gene:RNF130 / 55819 HGNCID:18280 Length:448 Species:Homo sapiens


Alignment Length:290 Identity:125/290 - (43%)
Similarity:170/290 - (58%) Gaps:10/290 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 YNYAFLNWSYVEHGNMLCNMEFAQEQARYG-EGKVLNVTGRLIHITATDNFSDDYACTPYIRGTL 130
            |..|.:|.:..|.|.. ..:.|..::.||| :.....|.|:::........:|...|.|..|.. 
Human    34 YYTALINVTVQEPGRG-APLTFRIDRGRYGLDSPKAEVRGQVLAPLPLHGVADHLGCDPQTRFF- 96

  Fly   131 GAPIPDKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYNDKQVMQLEKMQIKGKTRNIAAVIT 195
               :|...:.||||::||.|||:||:......||..|:|||:|...:...|...| |.:|.||:.
Human    97 ---VPPNIKQWIALLQRGNCTFKEKISRAAFHNAVAVVIYNNKSKEEPVTMTHPG-TGDIIAVMI 157

  Fly   196 YQNIGQDLSLTLDKGYNVTISIIEGRRGVRTISSLNRTSVLFVSISFIVLMIISLVWLIFYYIQR 260
            .:..|:|:...|:|..:|.::|..|.|  ....:.:|.|::|||||||||||||..|||||:||:
Human   158 TELRGKDILSYLEKNISVQMTIAVGTR--MPPKNFSRGSLVFVSISFIVLMIISSAWLIFYFIQK 220

  Fly   261 FRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSD-EKDLDSDCCAICIEAYKPTDTIRILPCKHE 324
            .||..|:|:..|.|....||||.|:.|:|.|..| |.|.|.|.||:|||:||..|.:|||||||.
Human   221 IRYTNARDRNQRRLGDAAKKAISKLTTRTVKKGDKETDPDFDHCAVCIESYKQNDVVRILPCKHV 285

  Fly   325 FHKNCIDPWLIEHRTCPMCKLDVLKFYGYV 354
            |||:|:||||.||.|||||||::||..|.|
Human   286 FHKSCVDPWLSEHCTCPMCKLNILKALGIV 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 43/144 (30%)
UPF0233 226..>258 CDD:299753 20/31 (65%)
zf-RING_2 301..344 CDD:290367 30/42 (71%)
RNF130XP_024301897.1 PA_GRAIL_like 40..179 CDD:239037 43/144 (30%)
zf-rbx1 <197..>306 CDD:331150 69/108 (64%)
RING_Ubox 262..310 CDD:327409 33/47 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7788
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 218 1.000 Inparanoid score I3586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 1 1.000 - - otm41809
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22765
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3602
SonicParanoid 1 1.000 - - X295
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1111.060

Return to query results.
Submit another query.