DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and zgc:175214

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001108199.1 Gene:zgc:175214 / 557610 ZFINID:ZDB-GENE-080303-32 Length:155 Species:Danio rerio


Alignment Length:139 Identity:39/139 - (28%)
Similarity:63/139 - (45%) Gaps:30/139 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 VSISFIVL---MIISLVWLIF-YYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSDEKDL 298
            :::..|||   |.|.::.:|| .|:.|.:....::|.|.|      :.::|   ..||   :..|
Zfish    33 LNVYVIVLGIGMFIFMLSVIFCCYLFRLKQQGTREQYSYN------EVVLK---GAGK---KLSL 85

  Fly   299 DSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYGYVFLGSEESIL 363
            ....||:|:|.:|..|.:.:.||.|.|||.|:..||.....||||...:::.             
Zfish    86 LGQPCAVCLEEFKTRDELGVCPCSHTFHKKCLLKWLEIRSVCPMCNKPIMRL------------- 137

  Fly   364 EYQPDPPQG 372
             ..||.|:|
Zfish   138 -QNPDAPRG 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
UPF0233 226..>258 CDD:299753 7/23 (30%)
zf-RING_2 301..344 CDD:290367 18/42 (43%)
zgc:175214NP_001108199.1 zf-RING_2 90..130 CDD:290367 17/39 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.