DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and chmp3

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_002937319.1 Gene:chmp3 / 548983 XenbaseID:XB-GENE-1005141 Length:681 Species:Xenopus tropicalis


Alignment Length:83 Identity:25/83 - (30%)
Similarity:40/83 - (48%) Gaps:16/83 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 CSVTKKAIMKIPTKTGKFSDEKDLDSD----------C--CAICIEAYKPTDTIRILPCKHEFHK 327
            ||.|::   |..:..|....:.|::.:          |  |.:|:|.::....:..|||.|.||:
 Frog   581 CSPTER---KTRSPYGSKCTKNDMEPNWASWPGNMLHCTECVVCLENFENGSLLMGLPCGHVFHQ 642

  Fly   328 NCIDPWLIEHR-TCPMCK 344
            |||..||...| .||:|:
 Frog   643 NCIVMWLAGGRHCCPVCR 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
UPF0233 226..>258 CDD:299753
zf-RING_2 301..344 CDD:290367 18/55 (33%)
chmp3XP_002937319.1 RING-H2_RNF103 617..661 CDD:319387 18/44 (41%)
RING-H2 finger (C3H2C3-type) 618..659 CDD:319387 17/40 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.