DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT2G44578

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001078058.1 Gene:AT2G44578 / 5007961 AraportID:AT2G44578 Length:145 Species:Arabidopsis thaliana


Alignment Length:147 Identity:37/147 - (25%)
Similarity:59/147 - (40%) Gaps:42/147 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 VSISFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKT-------GKFSDE 295
            ::.|.|:..::.|...:|:               |..|.:..::..:..|.|       .|.:.|
plant    13 IAESVIIASVVVLTLRLFF---------------RFACFLASRSWRRYRTFTVQHRRRWRKTAAE 62

  Fly   296 KDLDSDCCAICIE-AYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYGYVFLGSE 359
            :...|..|.||:| |.:.....||..|.|.||.:||||||::..|||:|:.::            
plant    63 EKHSSPYCTICLEDAAEGEKMRRITACSHCFHVDCIDPWLMKKSTCPLCRAEI------------ 115

  Fly   360 ESILEYQPDPPQGLALV 376
                   |..|.|..||
plant   116 -------PPVPPGNPLV 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 32/116 (28%)
RING-H2_RNF130-like 302..347 CDD:438330 21/45 (47%)
AT2G44578NP_001078058.1 RING_Ubox 70..112 CDD:473075 20/41 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.