DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and rnf13

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001008015.1 Gene:rnf13 / 493377 XenbaseID:XB-GENE-954771 Length:383 Species:Xenopus tropicalis


Alignment Length:296 Identity:69/296 - (23%)
Similarity:120/296 - (40%) Gaps:95/296 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 ACTPYIRGTLGAPIP----DKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYN---------- 171
            ||.|.      :|.|    :....:|.|::|..|.|:.||.:..:......::||          
 Frog    76 ACQPI------SPPPLLRDNTSSVFIVLIKRLECNFDLKVLNAQKAGFKAAVVYNVDSDDLISMG 134

  Fly   172 DKQVMQLEKMQI------KGKTRNIAAVITYQNIG-----QDLSLTLDKGYNVTISIIEGRRGVR 225
            ...|..|:::.|      :...|.:....:::..|     .||:|.|:                 
 Frog   135 SNDVDILKQIDIPSVFIGESSARFLKEEFSWEKGGYIVLVPDLTLPLE----------------- 182

  Fly   226 TISSLNRTSVLFVSISFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTG 290
                       :..|.|::::.|.||.::.:.|.:|  :|.:.:..||  .:.|..:.|:|....
 Frog   183 -----------YYLIPFLIIVGICLVLIVIFMITKF--VQDRHRARRN--RLRKDQLKKLPIHKF 232

  Fly   291 KFSDEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIE-HRTCPMCKLDVLKFYGYV 354
            |..||.|:    ||:|::.|:..|.:|||||.|.:|..|:||||.: .:|||:||..|:      
 Frog   233 KKGDEYDV----CAVCLDEYEEGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVV------ 287

  Fly   355 FLGSEESILEYQPDPPQGLALVEARDESADLNRSRD 390
                          |.||       |..:|.:.|::
 Frog   288 --------------PSQG-------DSESDSDSSQE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 23/120 (19%)
UPF0233 226..>258 CDD:299753 5/31 (16%)
zf-RING_2 301..344 CDD:290367 20/43 (47%)
rnf13NP_001008015.1 PA_C_RZF_like 24..181 CDD:239038 22/110 (20%)
RING_Ubox 239..284 CDD:388418 22/48 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.