DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and mura

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster


Alignment Length:69 Identity:26/69 - (37%)
Similarity:43/69 - (62%) Gaps:3/69 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 VTKKAIMKIPTKTGKFSDE-KDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTC 340
            :|:..|.::|:.  ||:.| .:.|...|.:|:..::....:|:|||.||||..|:|.||..:|||
  Fly  1052 LTRNEIDQLPSY--KFNPEVHNGDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTC 1114

  Fly   341 PMCK 344
            |:|:
  Fly  1115 PICR 1118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 26/69 (38%)
RING-H2_RNF130-like 302..347 CDD:438330 19/43 (44%)
muraNP_731367.2 RING-H2_RNF38-like 1073..1118 CDD:438135 19/44 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.