DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and Iru

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster


Alignment Length:42 Identity:22/42 - (52%)
Similarity:31/42 - (73%) Gaps:0/42 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 CAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCK 344
            |:||.:.:|..:|:|.|||.|.:|:|||.|||..|.|||:|:
  Fly   253 CSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 22/42 (52%)
RING-H2_RNF130-like 302..347 CDD:438330 22/42 (52%)
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:433910
RING-H2_RNF126-like 252..294 CDD:438329 21/40 (53%)
HRD1 <253..372 CDD:227568 22/42 (52%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.