DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and Znrf3

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001074393.1 Gene:Znrf3 / 407821 MGIID:3039616 Length:913 Species:Mus musculus


Alignment Length:331 Identity:80/331 - (24%)
Similarity:142/331 - (42%) Gaps:88/331 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 SDDYACTPYIRG------TLGAPIPDKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYNDKQV 175
            |.||  |.:..|      ..||.:..:||. :.:...|.|...:: :.:|:....||:.....::
Mouse    68 SGDY--TTHTTGLTGRFSRAGAMLSAEGEI-VQMHPLGLCNNNDE-EDLYEYGWVGVVKLEQPEL 128

  Fly   176 MQLEKMQIKGKT-----RNIAAVITYQNIGQDLSLTLDKG----YNVTISIIEGRRGVRTISSLN 231
            .....:.:.||.     |...|||...:...:....|::|    ....:..::|...::.::.:|
Mouse   129 DPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVN 193

  Fly   232 RTSV------------------LFVSISFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVT 278
            :..|                  :.:.::|.|  ::|||.||.  :.:.:..|.:.|.|.|..:| 
Mouse   194 KQKVARARIQHLPPRQPTEYFDMGIFLAFFV--VVSLVCLIL--LVKIKLKQRRSQNSMNRLAV- 253

  Fly   279 KKAIMKIPTKTGKFSDEKD---------LD-------SDCCAICIEAYKPTDTIRILPCKHEFHK 327
             :|:.|:.|:  ||:.:..         ||       || ||||:|.|...:.:|::||.|.||:
Mouse   254 -QALEKMETR--KFNSKSKGRREGSCGALDTLSSGSTSD-CAICLEKYIDGEELRVIPCTHRFHR 314

  Fly   328 NCIDPWLIEHRTCPMCKLDVLKFYGYVFLGSEESILEYQPDPPQGLALVEARDESADLNRSRDFV 392
            .|:||||::|.|||.|:               .:|:|.:.:|  |...|    |:::|.|.|.  
Mouse   315 KCVDPWLLQHHTCPHCR---------------HNIIEQKGNP--GAVCV----ETSNLTRGRQ-- 356

  Fly   393 VDFPRV 398
               |||
Mouse   357 ---PRV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 22/114 (19%)
UPF0233 226..>258 CDD:299753 9/49 (18%)
zf-RING_2 301..344 CDD:290367 22/42 (52%)
Znrf3NP_001074393.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
zf-RING_2 289..331 CDD:290367 22/42 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 601..669
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 855..913
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.