DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT3G60966

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001030907.1 Gene:AT3G60966 / 3769752 AraportID:AT3G60966 Length:139 Species:Arabidopsis thaliana


Alignment Length:56 Identity:19/56 - (33%)
Similarity:32/56 - (57%) Gaps:1/56 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 SDEKDLDSDCCAICIEAYKPTDTIRILP-CKHEFHKNCIDPWLIEHRTCPMCKLDV 347
            ::..|.....||:|::..:..:.:|.|. |:|.||.:|||.||.|...||:|:..:
plant    52 AENDDSSPPFCAVCLQEAEEGEKMRRLTICRHCFHADCIDTWLSEMSKCPLCRAQI 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 19/54 (35%)
RING-H2_RNF130-like 302..347 CDD:438330 18/45 (40%)
AT3G60966NP_001030907.1 RING_Ubox 62..104 CDD:473075 17/41 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.