DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and Rnf44

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_006253695.1 Gene:Rnf44 / 361212 RGDID:1307212 Length:433 Species:Rattus norvegicus


Alignment Length:80 Identity:29/80 - (36%)
Similarity:45/80 - (56%) Gaps:6/80 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 DQQSRNLCSVTKKAIMKIPTKTGKFS-DEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCID 331
            |.:.|.|   ||..|.::|:.  :|: |....:...|.:|...::....:|:|||.||||..|:|
  Rat   350 DAKPRGL---TKADIEQLPSY--RFNPDSHQSEQTLCVVCFSDFEVRQLLRVLPCNHEFHAKCVD 409

  Fly   332 PWLIEHRTCPMCKLD 346
            .||..:||||:|:.|
  Rat   410 KWLKANRTCPICRAD 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 29/80 (36%)
RING-H2_RNF130-like 302..347 CDD:438330 20/45 (44%)
Rnf44XP_006253695.1 RING_Ubox 372..433 CDD:473075 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.