powered by:
Protein Alignment gol and Srsf8
DIOPT Version :9
Sequence 1: | NP_001163300.1 |
Gene: | gol / 38006 |
FlyBaseID: | FBgn0004919 |
Length: | 601 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006257042.2 |
Gene: | Srsf8 / 317533 |
RGDID: | 1563383 |
Length: | 783 |
Species: | Rattus norvegicus |
Alignment Length: | 72 |
Identity: | 30/72 - (41%) |
Similarity: | 44/72 - (61%) |
Gaps: | 4/72 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 277 VTKKAIMKIPTKTGKFSDEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCP 341
:||:.|..:|.|| |.:...|:. |:|||..|.....||:|||.||:|..|||.||.::.|||
Rat 707 LTKEQINTLPVKT--FCENDKLNH--CSICITPYTQNSKIRVLPCFHEYHDKCIDRWLSDNSTCP 767
Fly 342 MCKLDVL 348
:|:..::
Rat 768 ICRKQII 774
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1487241at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.