powered by:
Protein Alignment gol and CG4325
DIOPT Version :9
Sequence 1: | NP_001163300.1 |
Gene: | gol / 38006 |
FlyBaseID: | FBgn0004919 |
Length: | 601 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001259169.1 |
Gene: | CG4325 / 31167 |
FlyBaseID: | FBgn0026878 |
Length: | 158 |
Species: | Drosophila melanogaster |
Alignment Length: | 58 |
Identity: | 21/58 - (36%) |
Similarity: | 35/58 - (60%) |
Gaps: | 1/58 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 303 CAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYGYVFLGSEE 360
|.||.|.::.:|.|:...|.|.||::|:|.|..:.||||:|:.....:: .::|..||
Fly 8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQDAAYF-QLYLDFEE 64
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000832 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.