DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and Rnf215

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_006251362.1 Gene:Rnf215 / 305478 RGDID:1310738 Length:383 Species:Rattus norvegicus


Alignment Length:288 Identity:63/288 - (21%)
Similarity:113/288 - (39%) Gaps:95/288 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 IPDKGETWIALVRRGRCTFEEKVKHVYQQN-AAGVIIYNDKQVMQLEKMQIKGKTRNIAAVITYQ 197
            ||..|  |||:...|:    |:|...:|:| .:....|....|.|:.:....|.:..:..::.:.
  Rat   107 IPADG--WIAVAYVGK----EQVAQFHQENQGSSQKAYPKALVQQMRRALFLGASALLLLILNHS 165

  Fly   198 NIGQ-DLS-------LTLDKGYNVT---ISIIEGRRGVRTISSLNRTSV---------------- 235
            .:.: |:|       :.|....|||   .::::..:....|||....|.                
  Rat   166 VVRELDISQLLLRPVIVLHYSSNVTKLLEALLQRTQATAEISSGESLSANIEWKLTLWTTCGLSK 230

  Fly   236 -------------------------LFVSISFIVLMIIS-LVWLIFYYIQRFRYMQAKDQQS--- 271
                                     |:.:|..:|:::.: ||      :|..|....:.||.   
  Rat   231 DGYGGWQDLVCLGGAQAQEQKPLQQLWNAILLVVMLLCTGLV------VQAQRQASRQSQQEPGG 289

  Fly   272 ----------RNLCSV------TKKAIMKIPTKTGKFSDEKDLDSDCCAICIEAYKPTDTIRILP 320
                      |.|.|:      ..:|...:|          :..::.||:|::.:.....:|:||
  Rat   290 QEDLFKRRVVRRLASLKTRRCRLSRAAHSLP----------EPGAETCAVCLDYFCNKQWLRVLP 344

  Fly   321 CKHEFHKNCIDPWLIEHRTCPMCKLDVL 348
            ||||||::|:||||:..:|||:||.:||
  Rat   345 CKHEFHRDCVDPWLMLQQTCPLCKFNVL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 21/94 (22%)
UPF0233 226..>258 CDD:299753 9/73 (12%)
zf-RING_2 301..344 CDD:290367 20/42 (48%)
Rnf215XP_006251362.1 zf-RING_2 325..368 CDD:290367 20/42 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.