DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and Znrf4

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001020049.1 Gene:Znrf4 / 301127 RGDID:1563631 Length:327 Species:Rattus norvegicus


Alignment Length:141 Identity:46/141 - (32%)
Similarity:67/141 - (47%) Gaps:37/141 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 SDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWL--IEHRTCPMCKLDVLKFY-----GYVFLG 357
            ||.||||::.|:..:.::||||.|.:|..|||||.  ...|:||:||..|...:     |.:  |
  Rat   206 SDLCAICLDDYEEGERLKILPCAHAYHCRCIDPWFSRAARRSCPLCKQSVASTHDGSTDGSI--G 268

  Fly   358 SEESILEYQPDPPQGLALVEARDESADLNRSRDFVVDFPRVFVLDSGCVVGAREMLFPCRIPERS 422
            .:|:.|.....|   :..::||      .|||       |:.:|       ||.:  |||   |.
  Rat   269 GDEAPLPGHRPP---IWAIQAR------LRSR-------RLELL-------ARTV--PCR---RC 305

  Fly   423 QSSLSLRQARD 433
            .|:.||..|.:
  Rat   306 NSTTSLGMAEN 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
UPF0233 226..>258 CDD:299753
zf-RING_2 301..344 CDD:290367 20/44 (45%)
Znrf4NP_001020049.1 Peptidases_S8_S53 31..>93 CDD:299169
zf-RING_2 207..252 CDD:290367 20/44 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.