DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and Rnf11

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_038904.1 Gene:Rnf11 / 29864 MGIID:1352759 Length:154 Species:Mus musculus


Alignment Length:54 Identity:23/54 - (42%)
Similarity:30/54 - (55%) Gaps:2/54 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 GKFSDEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMC 343
            |:...||.:..  |.||:..:...|.||.|||.|.:|.:|||.||:...|||.|
Mouse    88 GRDGSEKKIRE--CVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSC 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
UPF0233 226..>258 CDD:299753
zf-RING_2 301..344 CDD:290367 20/43 (47%)
Rnf11NP_038904.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
PPxY motif 37..40
RING-H2_RNF11 98..140 CDD:319382 20/44 (45%)
RING-H2 finger (C3H2C3-type) 99..139 CDD:319382 19/39 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.