DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT5G52155

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001332002.1 Gene:AT5G52155 / 28721267 AraportID:AT5G52155 Length:182 Species:Arabidopsis thaliana


Alignment Length:49 Identity:22/49 - (44%)
Similarity:30/49 - (61%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 DSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDV 347
            |...|:||:..|:..|.|..|||.|.:||:||..|..|:|.|.:||.:|
plant   133 DDSQCSICLVDYEKGDKIMTLPCNHIYHKDCISYWFKENRVCCVCKREV 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 21/47 (45%)
RING-H2_RNF130-like 302..347 CDD:438330 20/44 (45%)
AT5G52155NP_001332002.1 RING_Ubox 133..181 CDD:473075 21/47 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.