DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and RNF149

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_005263977.1 Gene:RNF149 / 284996 HGNCID:23137 Length:428 Species:Homo sapiens


Alignment Length:321 Identity:122/321 - (38%)
Similarity:175/321 - (54%) Gaps:19/321 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AFLNWSYVEHGNMLCNMEFAQEQARYGEGKVLNVTGRLIHITATDNFSDDYACTPYIRGTLGAPI 134
            |.:|..||:....| .:....|..|:|:.........|:.:..... .|...|.|..|..:..|.
Human    40 AVVNIEYVDPQTNL-TVWSVSESGRFGDSSPKEGAHGLVGVPWAPG-GDLEGCAPDTRFFVPEPG 102

  Fly   135 PDKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYNDKQVMQLEKMQIKGKTRNIAAVITYQNI 199
            ......|:|||.||.|||::||....::||:.|::||:::...:........|.||..::.....
Human   103 GRGAAPWVALVARGGCTFKDKVLVAARRNASAVVLYNEERYGNITLPMSHAGTGNIVVIMISYPK 167

  Fly   200 GQDLSLTLDKGYNVTISIIEGRRGVRTISSLNRTSVLFVSISFIVLMIISLVWLIFYYIQRFRY- 263
            |:::...:.||..||::|..|.|.|:..  ::..||:||:|:||.:|||||.||||||||||.| 
Human   168 GREILELVQKGIPVTMTIGVGTRHVQEF--ISGQSVVFVAIAFITMMIISLAWLIFYYIQRFLYT 230

  Fly   264 -MQAKDQQSRNLCSVTKKAIMKIPTKTGKFSDEK-DLDSDCCAICIEAYKPTDTIRILPCKHEFH 326
             .|...|..|   ..|||.|.::...|.|..::. |:|::.||:|||.:|..|.||||||||.||
Human   231 GSQIGSQSHR---KETKKVIGQLLLHTVKHGEKGIDVDAENCAVCIENFKVKDIIRILPCKHIFH 292

  Fly   327 KNCIDPWLIEHRTCPMCKLDVLKFYGYVFLGSEESILEY-QPDPPQGLALVEARDESADLN 386
            :.||||||::|||||||||||:|..||  .|....:.|. .|:.|.|      ||.:|:|:
Human   293 RICIDPWLLDHRTCPMCKLDVIKALGY--WGEPGDVQEMPAPESPPG------RDPAANLS 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 37/143 (26%)
UPF0233 226..>258 CDD:299753 17/31 (55%)
zf-RING_2 301..344 CDD:290367 29/42 (69%)
RNF149XP_005263977.1 PA_GRAIL_like 43..185 CDD:239037 37/143 (26%)
UPF0233 <204..>235 CDD:299753 21/30 (70%)
zf-RING_2 267..310 CDD:290367 29/42 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I7982
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 218 1.000 Inparanoid score I3586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 1 1.000 - - otm41809
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X295
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1010.030

Return to query results.
Submit another query.