DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT3G51325

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_974410.1 Gene:AT3G51325 / 2745959 AraportID:AT3G51325 Length:90 Species:Arabidopsis thaliana


Alignment Length:48 Identity:19/48 - (39%)
Similarity:29/48 - (60%) Gaps:2/48 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 DSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHR--TCPMCK 344
            :.:||::|:...:..|.|:.|||.||||..|:|.|....|  .||:|:
plant    22 EEECCSVCLMRMEAKDVIKSLPCSHEFHSLCVDTWFNVSRKICCPLCR 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 19/48 (40%)
RING-H2_RNF130-like 302..347 CDD:438330 19/45 (42%)
AT3G51325NP_974410.1 RING_Ubox 17..76 CDD:473075 19/48 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.