DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and RNF167

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001357232.1 Gene:RNF167 / 26001 HGNCID:24544 Length:374 Species:Homo sapiens


Alignment Length:339 Identity:90/339 - (26%)
Similarity:138/339 - (40%) Gaps:81/339 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NMEFAQEQARYG-----EGKVLNVTGRLIHITATDNFSDDYACTPYIRGTLGAPIPDKGETWIAL 144
            :|:||...|.:|     ||    :.|.|:..      ..|.||:|.   ....|.|..|..:|||
Human    35 SMDFADLPALFGATLSQEG----LQGFLVEA------HPDNACSPI---APPPPAPVNGSVFIAL 86

  Fly   145 VRRGRCTFEEKVKHVYQQNAAGVIIYNDKQVMQLEKMQIKGKTRNIAAVITYQN--IGQDLSLTL 207
            :||..|.|:.||.:..:......:::|   |...|.:.:...:..|...|...:  ||:..|   
Human    87 LRRFDCNFDLKVLNAQKAGYGAAVVHN---VNSNELLNMVWNSEEIQQQIWIPSVFIGERSS--- 145

  Fly   208 DKGYNVTISIIEGRRGVRTISSLNRTSVL-FVSISFIVLMIISLVWLIFYYIQRFRYMQAKDQQS 271
              .|...:.:.|  :|.|.:...:.|..| :..|.|  ..|:.|:.|....:...|.:|.:.:..
Human   146 --EYLRALFVYE--KGARVLLVPDNTFPLGYYLIPF--TGIVGLLVLAMGAVMIARCIQHRKRLQ 204

  Fly   272 RNLCSVTKKAIMKIPT------------------------KTGKFSDEKDLDSDCCAICIEAYKP 312
            ||  .:||:.:.:|||                        .||...|:.|:    ||||::.|:.
Human   205 RN--RLTKEQLKQIPTHDYQKALNSSMFCPDLILPTCLISSTGFVGDQYDV----CAICLDEYED 263

  Fly   313 TDTIRILPCKHEFHKNCIDPWLIEHR-TCPMCKLDVLKFYGYVFLGSEESILEYQPDPPQGLALV 376
            .|.:|:|||.|.:|..|:||||.:.| |||:||..|.:..|.          |.|.:..||    
Human   264 GDKLRVLPCAHAYHSRCVDPWLTQTRKTCPICKQPVHRGPGD----------EDQEEETQG---- 314

  Fly   377 EARDESADLNRSRD 390
               .|..|....||
Human   315 ---QEEGDEGEPRD 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 34/138 (25%)
UPF0233 226..>258 CDD:299753 7/32 (22%)
zf-RING_2 301..344 CDD:290367 21/43 (49%)
RNF167NP_001357232.1 PA_C_RZF_like 20..170 CDD:239038 38/157 (24%)
RING-H2_RNF167 252..297 CDD:319711 23/48 (48%)
RING-H2 finger (C3H2C3-type) 254..295 CDD:319711 21/40 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.