DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and meu34

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_593329.1 Gene:meu34 / 2543036 PomBaseID:SPAC3A12.03c Length:309 Species:Schizosaccharomyces pombe


Alignment Length:227 Identity:56/227 - (24%)
Similarity:87/227 - (38%) Gaps:57/227 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 LSLTLDKGYNVTISIIEGRRGVRTISSLNRTSVLFVSISFIVLMIISLVWLIFYYIQRFRYMQAK 267
            ||.::|:..||....|..||        .|:.|...::|.|.|.|..:.||      :.|...||
pombe    79 LSPSVDRLGNVLGYDIPSRR--------RRSVVSKEALSCISLEIPYIKWL------KKRKGHAK 129

  Fly   268 ------DQQSRNLCSVTK-------------------------------KAIMKIPTKTGKFSDE 295
                  |.:|.|...:.:                               ..|.......|..||:
pombe   130 GESTFLDNRSENQSVIVQGQGETPSVIITYDVRRPNLGSTSFVEMSSALSNIYNTDASDGDSSDD 194

  Fly   296 KDL---DSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHR-TCPMCKLDVLKFYGYVFL 356
            ..|   :.|.|.||...|...|.:|:|||:|.||..|||.|:...: :||:|..|..|:  ::.:
pombe   195 SCLLEDEEDFCIICYADYAFDDILRVLPCEHVFHTQCIDTWMTTMKASCPLCNEDYYKY--FLQM 257

  Fly   357 GSEESILEYQPDPPQGLALVEARDESADLNRS 388
            .:..|:..........|:..::|..||:.:||
pombe   258 DAASSVTHENAAWSIPLSPGDSRTHSAETDRS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 5/13 (38%)
UPF0233 226..>258 CDD:299753 8/31 (26%)
zf-RING_2 301..344 CDD:290367 19/43 (44%)
meu34NP_593329.1 RING 205..249 CDD:238093 19/43 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47219
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.