DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and SPAC57A7.09

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_593372.1 Gene:SPAC57A7.09 / 2542187 PomBaseID:SPAC57A7.09 Length:372 Species:Schizosaccharomyces pombe


Alignment Length:412 Identity:85/412 - (20%)
Similarity:150/412 - (36%) Gaps:134/412 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLACLVLLFGGLP----PLTFPATTT-----------------------TLVAAMSIANQDLER 44
            :||..:.|..|.|.    |..|.|:|.                       |..:|.::.|     
pombe    18 ILLEVIALDLGVLDNIFIPKRFAASTDVAIQLPDRNVTLWSRQAVFGKHFTNASATTVIN----- 77

  Fly    45 YFRPGNGTHSFSGMEDRIAVDVYNYAFLNWSYVEHGNML-CNMEFAQEQARYGEGKVLNVTGRLI 108
            .:.|.|.....||..:|...|.        ||....::: .::|:. ||..|.......|.    
pombe    78 LYLPSNFQEDMSGCPNRNDTDA--------SYFYENDIIDYDIEYI-EQKSYSSKPSARVQ---- 129

  Fly   109 HITATDNFSDDYACTPYIRGTLGAPIPDKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYNDK 173
                    .||           |....|:......||:||:||:.:|.....:....|||:    
pombe   130 --------KDD-----------GGESKDEAILDFLLVQRGKCTYFDKALEAQRLGFKGVIV---- 171

  Fly   174 QVMQLEKMQIKGKTRNIAAVITYQNIGQDL---------SLTLD-KGYNVTIS--IIEGRRGVRT 226
                       |..|:.::...:..:..|.         ||.:. ..||:..|  :...|:.::.
pombe   172 -----------GDNRSPSSFRLHYMVAPDKVDESKVHIPSLFVSTSSYNLLWSDLLHSYRQPLKL 225

  Fly   227 ISSLNRTSVLF----VSISFIVLMIISLVWL-IFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIP 286
            .:.......:|    :..|..::|:|::..| |..:|:.:|..           |.|::.|..:|
pombe   226 YAKPEELGDMFWPFLLCFSPSIIMLITVQALAIRKFIRTYRTK-----------SKTRRFIEDLP 279

  Fly   287 TKT----GKFSDEKDLDSDC---------------------CAICIEAYKPTDTIRILPCKHEFH 326
            ::|    |.:|:|:::::..                     |.||:|::...|.:..||||||||
pombe   280 SRTISREGFYSEEEEIENSTQNGELVPLMDESTRRATFGVECVICLESFTKGDKVVALPCKHEFH 344

  Fly   327 KNCIDPWLIEHR-TCPMCKLDV 347
            :.||..|::::| .||.|..:|
pombe   345 RPCIAKWIVDYRHACPTCNTEV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 29/156 (19%)
UPF0233 226..>258 CDD:299753 6/36 (17%)
zf-RING_2 301..344 CDD:290367 19/64 (30%)
SPAC57A7.09NP_593372.1 COG5540 1..369 CDD:227827 85/412 (21%)
Peptidases_S8_S53 <144..211 CDD:299169 17/81 (21%)
zf-RING_2 320..362 CDD:290367 19/41 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.