DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and SPOM_SPBP4H10.07

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_596181.1 Gene:SPOM_SPBP4H10.07 / 2541304 PomBaseID:SPBP4H10.07 Length:583 Species:Schizosaccharomyces pombe


Alignment Length:65 Identity:20/65 - (30%)
Similarity:32/65 - (49%) Gaps:13/65 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 SDEKDLD-----------SDCCAICIEAYKPTDTIRIL-PCKHEFHKNCIDPWLI-EHRTCPMCK 344
            :.:|||:           .:.|.:|:..::..|..|.| .|.|.||:.|||.||. ...:||:|:
pombe   504 ASQKDLEKAGGVFPFSGTDERCLVCLSNFELNDECRRLKQCNHFFHRECIDQWLTSSQNSCPLCR 568

  Fly   345  344
            pombe   569  568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 20/65 (31%)
RING-H2_RNF130-like 302..347 CDD:438330 17/45 (38%)
SPOM_SPBP4H10.07NP_596181.1 RING-H2_EL5-like 524..568 CDD:438124 16/43 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.