DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and 4930595M18Rik

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_775611.2 Gene:4930595M18Rik / 245492 MGIID:3045300 Length:829 Species:Mus musculus


Alignment Length:339 Identity:62/339 - (18%)
Similarity:121/339 - (35%) Gaps:61/339 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 NGTHSFSGMEDRIAVDVYN--YAFLNWSYVEH-----------GNMLCNMEFAQEQARYGEGKVL 101
            :.:|:|..:.|.:|:....  |.|.::..:||           ...:...:|...:....|....
Mouse   503 SNSHTFLPLRDNLAISELQKLYFFPSFPTIEHILTESTAHRSQSTSVTPTKFTTVEIDQKEHTKT 567

  Fly   102 NVTGRLIHITATDNFSDDYACTPYIRGTL-GAPIPDKGETWIALVRRGRCTFEEKVKHVYQQNAA 165
            :.......|..:|..|||......:..|: .||....|.     :..|....::.......|:..
Mouse   568 SSCSNQTDIQISDVISDDETLNTNLECTIPSAPCETSGN-----IMLGVFEVDDNFTEFDLQSCD 627

  Fly   166 GVIIYNDKQV-------------MQLEKMQIKGKTRNIAAVITYQNIGQDLSLTLDKGYNVTISI 217
            .:...|:::|             :............::.:::.|......:|.|.|       :|
Mouse   628 SLSSQNNRRVHSGHSRISRSVSSLNSNSTTSSSTNHSLLSLLNYSQQFLPVSSTSD-------NI 685

  Fly   218 IEGRRGVRTISSLNRTS---VLFVSISFIVLMIISLV----------WLIFYYIQRFRYMQAKDQ 269
            |.....:...|.:|:.|   ::|....|.....:.:.          |.:......|     .|.
Mouse   686 IGNDINLPHTSQINQESNEFIVFNCPPFEARQQMHVTSPETSNDSDYWPVLPDFSNF-----NDI 745

  Fly   270 QSRNLCSVTKKAIMKIPTKTGKFSDEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWL 334
            .:.:...:|::.|..:|..  .|.:..::..  |:||:..|.....||:|||.||:|..|||.||
Mouse   746 HNNHPKGLTEEQINNLPVI--YFCENDEISH--CSICLTQYIKNSKIRVLPCFHEYHDKCIDRWL 806

  Fly   335 IEHRTCPMCKLDVL 348
            .::.|||:|:..::
Mouse   807 SDNSTCPICRKHII 820

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 21/168 (13%)
UPF0233 226..>258 CDD:299753 6/44 (14%)
zf-RING_2 301..344 CDD:290367 20/42 (48%)
4930595M18RikNP_775611.2 RRM <14..176 CDD:223796
RRM_SF 16..88 CDD:302621
zf-RING_2 775..816 CDD:290367 20/40 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.