DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and Rnf13

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001106884.1 Gene:Rnf13 / 24017 MGIID:1346341 Length:381 Species:Mus musculus


Alignment Length:395 Identity:102/395 - (25%)
Similarity:158/395 - (40%) Gaps:111/395 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GMEDRIAVDVYN------YAFLNWSYVEHGNMLCNMEFAQE-----QARYG-----EGKVLNVTG 105
            ||....|..||.      :||||...||...:..|.|.|.:     .||:|     ||    :.|
Mouse     6 GMLMLSATQVYTILTVQLFAFLNLLPVEADILAYNFENASQTFEDLPARFGYRLPAEG----LKG 66

  Fly   106 RLIHITATDNFSDDYACTPYIRGTLGAPIPDKGE-TWIALVRRGRCTFEEKVKHVYQQNAAGVII 169
            .||      |...:.||.|.:    ..|:.|... |:|.|:||..|.|:.||.:..:......|:
Mouse    67 FLI------NSKPENACEPIV----PPPLKDNSSGTFIVLIRRLDCNFDIKVLNAQRAGYKAAIV 121

  Fly   170 YN----------DKQVMQLEKMQI------KGKTRNIAAVITYQNIGQ-----DLSLTLDKGYNV 213
            :|          ...:..|:|:.|      :....::....||:..|.     :|||.|:     
Mouse   122 HNVDSDDLISMGSNDIDTLKKIDIPSVFIGESSANSLKDEFTYEKGGHIILVPELSLPLE----- 181

  Fly   214 TISIIEGRRGVRTISSLNRTSVLFVSISFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVT 278
                                   :..|.|::::.|.|:.::.:.|.:|  :|.:.:..||  .:.
Mouse   182 -----------------------YYLIPFLIIVGICLILIVIFMITKF--VQDRHRNRRN--RLR 219

  Fly   279 KKAIMKIPTKTGKFSDEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIE-HRTCPM 342
            |..:.|:|....|..||.|:    ||||:|.|:..|.:|||||.|.:|..|:||||.: .:|||:
Mouse   220 KDQLKKLPVHKFKKGDEYDV----CAICLEEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPV 280

  Fly   343 CKLDVLKFYGYVFLGSEES-----ILEYQP-DPPQGLA----------------LVEARDESADL 385
            ||..|:...|.....::.|     :.|:.| .||...|                :.|:.|...|.
Mouse   281 CKQKVVPSQGDSDSDTDSSQEENQVSEHTPLLPPSASARTQSFGSLSESHSHHNMTESSDYEDDD 345

  Fly   386 NRSRD 390
            |...|
Mouse   346 NEETD 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 41/175 (23%)
UPF0233 226..>258 CDD:299753 4/31 (13%)
zf-RING_2 301..344 CDD:290367 22/43 (51%)
Rnf13NP_001106884.1 PA_C_RZF_like 23..180 CDD:239038 43/170 (25%)
RING-H2_RNF167 238..283 CDD:319711 24/48 (50%)
RING-H2 finger (C3H2C3-type) 240..281 CDD:319711 22/40 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..381 13/66 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.