DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and Rlim

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001345134.1 Gene:Rlim / 19820 MGIID:1342291 Length:600 Species:Mus musculus


Alignment Length:112 Identity:38/112 - (33%)
Similarity:60/112 - (53%) Gaps:14/112 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 LIFYYIQRFRYMQAKDQ-QSRNLCSVTKKAIMKIPTKTGKFSDEKDLDSDCCAICIEAYKPTDTI 316
            |.|..:.:|..:...|: |.|.|   ||:.|..:..::  |.:...|.:  |::||..|...:.:
Mouse   502 LPFLSLAQFFLLNEDDEDQPRGL---TKEQIDNLAMRS--FGENDALKT--CSVCITEYTEGNKL 559

  Fly   317 RILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYGYVFLGSEESIL 363
            |.|||.||:|.:|||.||.|:.|||:|:..||.      .|:.||::
Mouse   560 RKLPCSHEYHVHCIDRWLSENSTCPICRRAVLS------SGNRESVV 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
UPF0233 226..>258 CDD:299753 2/4 (50%)
zf-RING_2 301..344 CDD:290367 20/42 (48%)
RlimNP_001345134.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..355
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 417..497
RING_Ubox 544..588 CDD:388418 21/45 (47%)
PDZ-binding. /evidence=ECO:0000255 597..600 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.