DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and Pja2

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_620251.1 Gene:Pja2 / 192256 RGDID:620273 Length:707 Species:Rattus norvegicus


Alignment Length:161 Identity:41/161 - (25%)
Similarity:65/161 - (40%) Gaps:34/161 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 NIGQDLSLT--LDKGYNVTISIIEGRRGVRTISSLNRTSVLFVSISFIVLMIISLVWLIFYYIQR 260
            |:..|.|::  ||..:::.....:|......||        :|...|:..|.:           .
  Rat   534 NLEDDSSVSEDLDVDWSLFDGFADGLGVAEAIS--------YVDPQFLTYMAL-----------E 579

  Fly   261 FRYMQAKDQQSRNLCSV-----------TKKAIMKIPTKTGKFSDEKDLDSD-CCAICIEAYKPT 313
            .|..||.:....:|.|:           :|::|..:| :|....|...:..: ||.||...|...
  Rat   580 ERLAQAMETALAHLESLAVDVEVANPPASKESIDGLP-ETLVLEDHTAIGQEQCCPICCSEYIKD 643

  Fly   314 DTIRILPCKHEFHKNCIDPWLIEHRTCPMCK 344
            |....|||.|.|||.|:..||.:..|||:|:
  Rat   644 DIATELPCHHFFHKPCVSIWLQKSGTCPVCR 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 5/20 (25%)
UPF0233 226..>258 CDD:299753 5/31 (16%)
zf-RING_2 301..344 CDD:290367 19/43 (44%)
Pja2NP_620251.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..120
PRK11151 210..>241 CDD:182999
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..290
MDN1 <269..628 CDD:227596 21/113 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..403
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..493
Interaction with PRKAR1A, PRKAR2A and PRKAR2B. /evidence=ECO:0000250 530..707 41/161 (25%)
RING-H2_PJA1_2 632..677 CDD:319379 20/43 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 686..707
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.