DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and Pja1

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001277484.1 Gene:Pja1 / 18744 MGIID:1101765 Length:615 Species:Mus musculus


Alignment Length:331 Identity:70/331 - (21%)
Similarity:119/331 - (35%) Gaps:107/331 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 FAQEQ-ARYGEGKVLNVTGRLIHITATD--NFSDDYACTPYIRGTLGAPIPDKGETWIALVRRGR 149
            :|::| ||..:.|...|..|...:...|  .::|||  ..|....     .|..:.|:|.:||..
Mouse   311 YAEDQDARSEQAKADKVPRRRRTMADPDFWAYTDDY--YRYYEED-----SDSDKEWMAALRRKY 368

  Fly   150 CTFEEKVKHVYQQNAAGVI--IYNDKQVMQLEKMQIKGKTRNIAAVIT----YQNIGQDLSL--- 205
            .:.|:      .|:::|..  :...|:  :||:.|  ....::|:..:    |....||.||   
Mouse   369 RSREQ------PQSSSGESWELLPGKE--ELERQQ--AGAGSLASAGSNGSGYPEEVQDPSLQEE 423

  Fly   206 ---TLDKG------YNVTIS------------------IIEGRRGVRTISSLNR----------- 232
               :|::|      ||...|                  :::|...:...||::.           
Mouse   424 EQASLEEGEIPWLRYNENESSSEGDNESTHELIQPGMFMLDGNNNLEDDSSVSEDLEVDWSLFDG 488

  Fly   233 --------TSVLFVSISFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSV-----------T 278
                    .::.:|...|:..|.:           ..|..||.:....:|.|:           :
Mouse   489 FADGLGVAEAISYVDPQFLTYMAL-----------EERLAQAMETALAHLESLAVDVEVANPPAS 542

  Fly   279 KKAIMKIP-----TKTGKFSDEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHR 338
            |::|..:|     ...|....|.     ||.||...|...:....|||.|.|||.|:..||.:..
Mouse   543 KESIDALPEILVTEDHGAVGQEM-----CCPICCSEYVKGEVATELPCHHYFHKPCVSIWLQKSG 602

  Fly   339 TCPMCK 344
            |||:|:
Mouse   603 TCPVCR 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 35/167 (21%)
UPF0233 226..>258 CDD:299753 5/50 (10%)
zf-RING_2 301..344 CDD:290367 18/42 (43%)
Pja1NP_001277484.1 RING-H2_PJA1_2 566..611 CDD:319379 19/43 (44%)
RING-H2 finger (C3H2C3-type) 567..607 CDD:319379 17/39 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.