DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and ZK637.14

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_498962.1 Gene:ZK637.14 / 176251 WormBaseID:WBGene00014031 Length:161 Species:Caenorhabditis elegans


Alignment Length:92 Identity:25/92 - (27%)
Similarity:42/92 - (45%) Gaps:22/92 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 VTKKAIMKIPTKTGKFSDEKDLDSDCCAICIEAYK-----PTD----------------TIRILP 320
            :.||:...:.....:.:|::..|: .||||::..:     |.|                |:.::|
 Worm    47 IDKKSYKALRLMDRETTDQQKEDA-TCAICLDNLQNNVDIPEDHVIKEELKIDPTTFGTTVIVMP 110

  Fly   321 CKHEFHKNCIDPWLIEHRTCPMCKLDV 347
            |||.||..|:..||...:|||.|:..|
 Worm   111 CKHRFHYFCLTLWLEAQQTCPTCRQKV 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 24/90 (27%)
RING-H2_RNF130-like 302..347 CDD:438330 20/65 (31%)
ZK637.14NP_498962.1 RING-H2_RNF103 66..140 CDD:438136 22/73 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.