DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and RNF38

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_047278750.1 Gene:RNF38 / 152006 HGNCID:18052 Length:619 Species:Homo sapiens


Alignment Length:71 Identity:25/71 - (35%)
Similarity:43/71 - (60%) Gaps:3/71 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 VTKKAIMKIPTKTGKFS-DEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTC 340
            :||..|.::|:.  :|: :....:...|.:|:..::....:|:|||.||||..|:|.||..:|||
Human   542 LTKADIEQLPSY--RFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTC 604

  Fly   341 PMCKLD 346
            |:|:.|
Human   605 PICRAD 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 25/71 (35%)
RING-H2_RNF130-like 302..347 CDD:438330 20/45 (44%)
RNF38XP_047278750.1 RING-H2_RNF38 545..611 CDD:438341 23/68 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.