powered by:
Protein Alignment gol and RNF38
DIOPT Version :9
Sequence 1: | NP_001163300.1 |
Gene: | gol / 38006 |
FlyBaseID: | FBgn0004919 |
Length: | 601 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_073618.3 |
Gene: | RNF38 / 152006 |
HGNCID: | 18052 |
Length: | 515 |
Species: | Homo sapiens |
Alignment Length: | 71 |
Identity: | 25/71 - (35%) |
Similarity: | 43/71 - (60%) |
Gaps: | 3/71 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 277 VTKKAIMKIPTKTGKFS-DEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTC 340
:||..|.::|:. :|: :....:...|.:|:..::....:|:|||.||||..|:|.||..:|||
Human 438 LTKADIEQLPSY--RFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTC 500
Fly 341 PMCKLD 346
|:|:.|
Human 501 PICRAD 506
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.