DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment gol and RNF38

DIOPT Version :9

Sequence 1:	NP_001163300.1	Gene:	gol / 38006	FlyBaseID:	FBgn0004919	Length:	601	Species:	Drosophila melanogaster
Sequence 2:	NP_073618.3	Gene:	RNF38 / 152006	HGNCID:	18052	Length:	515	Species:	Homo sapiens

Alignment Length:	71	Identity:	25/71 - (35%)
Similarity:	43/71 - (60%)	Gaps:	3/71 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   277 VTKKAIMKIPTKTGKFS-DEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTC 340
            :||..|.::|:.  :|: :....:...|.:|:..::....:|:|||.||||..|:|.||..:|||
Human   438 LTKADIEQLPSY--RFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTC 500

  Fly   341 PMCKLD 346
            |:|:.|
Human   501 PICRAD 506

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
gol	NP_001163300.1	PA_GRAIL_like	73..217	CDD:239037
		UPF0233	226..>258	CDD:299753
		zf-RING_2	301..344	CDD:290367	18/42 (43%)
RNF38	NP_073618.3	Bipartite nuclear localization signal 1	57..71
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	73..141
		Bipartite nuclear localization signal 2	115..131
		RING-H2_RNF38_like	460..504	CDD:319386	18/43 (42%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910