DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and rnf215

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_005165127.1 Gene:rnf215 / 101882431 ZFINID:ZDB-GENE-060526-65 Length:351 Species:Danio rerio


Alignment Length:239 Identity:65/239 - (27%)
Similarity:110/239 - (46%) Gaps:47/239 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 KVKHVYQQNAAGVII--YNDKQVMQLEKMQIKGK-----------TRNIAAV---------ITYQ 197
            |:|......|:.:||  .|...|.:::..|:..|           |:.|.|:         |||:
Zfish   118 KMKRALVLGASALIILALNQNTVREMDLSQVLSKPIIVIQTSENVTKLIGALLRGLRATAKITYK 182

  Fly   198 NIGQDLSLTLDKGYNVTISIIEGR---------RGVRTISSLNRTSVLFVSISFIVLMIISLVWL 253
            :..|| ||    |..:|:....||         :||......|.....::...:..:::::||..
Zfish   183 SFLQD-SL----GATLTLWSSCGRSRGGLYGEWQGVICTGETNSQVQKYLQQLWNTVVLVALVLS 242

  Fly   254 IFYYIQ-RFRYM--QAKDQQSRNLCSVTKKAIMKIPTKTGKF-------SDEKDLDSDCCAICIE 308
            ....:| |::|.  |..|....||.....|.:..:.|:|.:.       :..:.::::.||:|:|
Zfish   243 TGVIVQARWQYQDNQFNDDLESNLKQDILKRLSALKTRTYRQPKVRCDPTQTQTMETESCAVCLE 307

  Fly   309 AYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVL-KFY 351
            .|.....:|:|||.||||::|:||||:..:|||:||..|| .||
Zfish   308 QYNNNQCLRVLPCLHEFHRDCVDPWLLLQQTCPLCKRSVLGNFY 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 21/83 (25%)
UPF0233 226..>258 CDD:299753 3/31 (10%)
zf-RING_2 301..344 CDD:290367 21/42 (50%)
rnf215XP_005165127.1 zf-RING_2 300..343 CDD:290367 21/42 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.