DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and rnf167

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_005165694.2 Gene:rnf167 / 101055497 ZFINID:ZDB-GENE-110126-2 Length:401 Species:Danio rerio


Alignment Length:333 Identity:93/333 - (27%)
Similarity:139/333 - (41%) Gaps:68/333 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 YVEHGNMLCNMEFAQEQARYGEGKVLN-VTGRLIHITATDNFSDDYACTPYIRGTLGAPIP-DKG 138
            |..:.|| .:|.|....|.:|.....: :.|.||.....:      |||| |.....:|.| |..
Zfish    30 YAHYSNM-TSMLFEDLPALFGSALPKDGLMGVLIEARPQN------ACTP-IDPPPASPTPADPN 86

  Fly   139 ET--WIALVRRGRCTFEEKVKHVYQQNAAGVIIYNDKQVMQLEKMQIKGKTRNIAAVITYQN--I 199
            .|  :|.|:||..|.|:.||.|..|...:..|::|    |....:...|          |.|  |
Zfish    87 STTKYIVLIRRYDCNFDVKVYHAQQAGYSAAIVHN----MYSNSLLNMG----------YSNETI 137

  Fly   200 GQDLSLTLDKGYNVTISIIEGRRGVRTISSLNRTSVLFVSISF-----------IVLMIISLVWL 253
            .:::|:.     :|..|....:...:.|.......||....||           :|.|||    :
Zfish   138 AEEISIP-----SVFTSFFASQMLHKIIPEKGAYVVLKPEFSFPL
SYYLIPFTGVVCMII----I 193

  Fly   254 IFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSDEKDLDSDCCAICIEAYKPTDTIRI 318
            :...|...|.:|.:.:..:|  .::|:.:.|||..  ||:  |....|.||||::.|:..|.:|:
Zfish   194 VMVIIMIVRCVQHRKRLRKN--RLSKEQLKKIPIH--KFN--KGDSYDVCAICLDEYEEGDKLRV 252

  Fly   319 LPCKHEFHKNCIDPWLIE-HRTCPMCKLDVLK---FYGYVFLGSEESILEYQPDPPQGLALVEAR 379
            |||.|.:|..|:||||.: .:|||:||..|.:   .|      ||.|..:.:..|..    .|..
Zfish   253 LPCSHAYHSRCVDPWLTQTKKTCPVCKQRVTRPNPEY------SESSDSDEEAGPHD----AEEE 307

  Fly   380 DESADLNR 387
            ||...|.|
Zfish   308 DERTPLLR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 38/146 (26%)
UPF0233 226..>258 CDD:299753 9/42 (21%)
zf-RING_2 301..344 CDD:290367 21/43 (49%)
rnf167XP_005165694.2 PA_C_RZF_like 14..177 CDD:239038 44/173 (25%)
RING-H2_RNF167 235..280 CDD:319711 22/44 (50%)
RING-H2 finger (C3H2C3-type) 237..278 CDD:319711 20/40 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.