DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and rnf167

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_031755442.1 Gene:rnf167 / 100379947 XenbaseID:XB-GENE-5944055 Length:346 Species:Xenopus tropicalis


Alignment Length:252 Identity:77/252 - (30%)
Similarity:117/252 - (46%) Gaps:65/252 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 ACTPYIRGTLGAPIPDKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYNDKQVMQLEKMQIKG 185
            ||||.:     .|..|.|.::|.|:||..|.|:.||.|.   ..||   ||              
 Frog    72 ACTPIL-----PPPTDNGTSFIVLIRRNDCNFDTKVLHA---QLAG---YN-------------- 111

  Fly   186 KTRNIAAVITYQNIGQDLSLTLDKGYN-------VTI-SIIEGRRGVRTI----SSLNRTSVLFV 238
                 ||::  .|:|.||.|.:  |:|       :.| |:..|....|::    |..|.:.:..|
 Frog   112 -----AAIV--HNVGADLLLRM--GWNDESIRRQIRIPSVFTGESSGRSLLANFSYYNNSHIYLV 167

  Fly   239 S----------ISFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFS 293
            .          |.|||  ::|:|.::...:...|..|.:.:..||  .::|:.:.|||....|..
 Frog   168 PDYYFSLGYYLIPFIV--VVSVVIVVMCIVMVVRCAQYRKRMRRN--RLSKEQLKKIPIHKFKKG 228

  Fly   294 DEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIE-HRTCPMCKLDVLK 349
            |    |.|.||||:|.|:..|.:|:|||.|.:|.:|:||||.: .::||:||..|.:
 Frog   229 D----DYDVCAICLEEYEEGDKLRVLPCSHAYHCSCVDPWLTKTKKSCPVCKNRVFR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 30/103 (29%)
UPF0233 226..>258 CDD:299753 9/45 (20%)
zf-RING_2 301..344 CDD:290367 21/43 (49%)
rnf167XP_031755442.1 PA_C_RZF_like 17..174 CDD:239038 36/135 (27%)
RING_Ubox 232..277 CDD:418438 22/44 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.