DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and rnf150

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001135553.1 Gene:rnf150 / 100216098 XenbaseID:XB-GENE-5993052 Length:427 Species:Xenopus tropicalis


Alignment Length:332 Identity:130/332 - (39%)
Similarity:190/332 - (57%) Gaps:25/332 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AFLNWSYVEHGNMLCNMEFAQEQARYGEGKVLNVTGRLIHITATDNFSDDYACTPYIRGTLGAPI 134
            ||:|.:|.:..:.....| ..|..||||..:......|..:.::.  .|..||.|..:.:    :
 Frog    42 AFVNITYTDPLSHQWRTE-KSECGRYGEHSLKQDAWGLAVMPSSP--QDRLACDPATKFS----V 99

  Fly   135 PDKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYN--DKQVMQLEKMQIKGKTRNIAAVITYQ 197
            |.....|:||:.:|.||:.:|:||...|||:.|:|||  .....:...|...| ..:|.|::..:
 Frog   100 PANASRWVALIPKGNCTYRDKIKHAALQNASAVLIYNVGSSNANETITMPHPG-IEDIVAIMIPE 163

  Fly   198 NIGQDLSLTLDKGYNVTISIIEGRRGVRTISSLNRTSVLFVSISFIVLMIISLVWLIFYYIQRFR 262
            ..|::::..|::..||||.|..|.|.::  ..::||||:||||||||||||||.||:||||||||
 Frog   164 PKGREIATLLERNINVTIYITIGTRNLQ--KYVSRTSVVFVSISFIVLMIISLAWLVFYYIQRFR 226

  Fly   263 YMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSD-EKDLDSDCCAICIEAYKPTDTIRILPCKHEFH 326
            |..|:|:..|.|....||||.|:..:|.|..| |.:.:.|.||:|||.|||.|.:|||||:|.||
 Frog   227 YANARDRNQRRLGDAAKKAISKLQVRTIKKGDKETEPEFDNCAVCIEGYKPNDVVRILPCRHLFH 291

  Fly   327 KNCIDPWLIEHRTCPMCKLDVLKFYGYVFLGSEESILEYQPD------PP----QGLALVEARDE 381
            |:|:||||::||||||||:::||..|  ...:.:.:.:..||      ||    .|.:.|...:.
 Frog   292 KSCVDPWLLDHRTCPMCKMNILKALG--IPPNADCLDDIPPDFEGSVGPPTNQITGASDVTVNES 354

  Fly   382 SADLNRS 388
            |..::.|
 Frog   355 SVGIDPS 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 40/145 (28%)
UPF0233 226..>258 CDD:299753 22/31 (71%)
zf-RING_2 301..344 CDD:290367 30/42 (71%)
rnf150NP_001135553.1 PA_GRAIL_like 45..183 CDD:239037 40/145 (28%)
UPF0233 <197..>222 CDD:299753 21/24 (88%)
zf-RING_2 266..309 CDD:290367 30/42 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I7883
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 223 1.000 Inparanoid score I3429
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 1 1.000 - - otm49035
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3602
SonicParanoid 1 1.000 - - X295
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.