DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and rnf130

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001107712.1 Gene:rnf130 / 100124963 XenbaseID:XB-GENE-949564 Length:419 Species:Xenopus tropicalis


Alignment Length:304 Identity:123/304 - (40%)
Similarity:167/304 - (54%) Gaps:38/304 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SYVEHGNMLCNME-------------------FAQEQARYG------EGKVLNVTGRLIHITATD 114
            |.|:.|:...|||                   ...:..|||      |.|.|.:|...||..|  
 Frog    22 SMVQSGSDTANMENYSALVNVTIQDPSSNPVLLRIDGGRYGLDSPKTEAKGLLLTPVHIHGAA-- 84

  Fly   115 NFSDDYACTPYIRGTLGAPIPDKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYNDKQVMQLE 179
               |...|.|..|..    :|...:.||||::||.|||:||:......||:.|:|||:....:..
 Frog    85 ---DRLGCDPQTRFN----VPPNTKHWIALLQRGNCTFKEKILRAASHNASAVVIYNNNSKEETV 142

  Fly   180 KMQIKGKTRNIAAVITYQNIGQDLSLTLDKGYNVTISIIEGRRGVRTISSLNRTSVLFVSISFIV 244
            .|..:| |..|.|::..:..|:::...:::..:|.::|..|.|...  .:.:|.|::||||||||
 Frog   143 TMTHQG-TGEIVAIMISEARGREILSYVERNISVLMAIAVGSRNQH--KNFSRGSLVFVSISFIV 204

  Fly   245 LMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSD-EKDLDSDCCAICIE 308
            |||||..|||||:||:.||..|:|:..|.|....||||.|:.|:|.|..| |.|.|.|.||:|||
 Frog   205 LMIISSAWLIFYFIQKIRYTSARDRNQRRLGDAAKKAIGKLTTRTVKKGDKETDPDFDHCAVCIE 269

  Fly   309 AYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYG 352
            :||..|.:|:|||||.|||.|:||||.||.|||||||::||..|
 Frog   270 SYKQNDIVRVLPCKHVFHKVCVDPWLSEHCTCPMCKLNILKALG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 45/166 (27%)
UPF0233 226..>258 CDD:299753 20/31 (65%)
zf-RING_2 301..344 CDD:290367 29/42 (69%)
rnf130NP_001107712.1 PA_GRAIL_like 41..179 CDD:239037 39/147 (27%)
HRD1 <197..344 CDD:227568 73/117 (62%)
RING_Ubox 262..310 CDD:388418 32/47 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 78 1.000 Domainoid score I8659
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 223 1.000 Inparanoid score I3429
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 1 1.000 - - otm49035
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X295
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.