DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and MIXL1

DIOPT Version :9

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001269331.1 Gene:MIXL1 / 83881 HGNCID:13363 Length:240 Species:Homo sapiens


Alignment Length:209 Identity:62/209 - (29%)
Similarity:85/209 - (40%) Gaps:45/209 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 PSVSSISRLLRGSSGSGTSHSIDGILGGGAG-------SVGSEDESEDDAEPSVQLKRKQRRSRT 190
            |..|..:.||..........:..|.||...|       |:||....:..|.||.    .|||.||
Human    31 PPPSPAAALLPAPPAGPGPATFAGFLGRDPGPAPPPPASLGSPAPPKGAAAPSA----SQRRKRT 91

  Fly   191 TFSNDQIDALERIFARTQYPDVYTREELAQSTGLTEARV--------QVWFSNRRARLRKQLNTQ 247
            :||.:|:..||.:|.||:|||::.||.||..|.|.|:|:        ||||.||||:.|:|....
Human    92 SFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQLLFSPLFQVWFQNRRAKSRRQSGKS 156

  Fly   248 QVPSFAPTSTSFGATPTT---------------SAAPAPNMGMSLYSSQSWPSSGAYENHAAYGG 297
            ..|...|........|.|               :..|.|| |:          .|...:.::.|.
Human   157 FQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPN-GV----------GGGISDSSSQGQ 210

  Fly   298 SVASMSPASSTSGT 311
            :..:.||.|...|:
Human   211 NFETCSPLSEDIGS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645 3/9 (33%)
homeodomain 186..243 CDD:238039 32/64 (50%)
MIXL1NP_001269331.1 Homeobox 89..150 CDD:278475 29/60 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.