DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and HB53

DIOPT Version :10

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_201471.1 Gene:HB53 / 836803 AraportID:AT5G66700 Length:228 Species:Arabidopsis thaliana


Alignment Length:80 Identity:24/80 - (30%)
Similarity:41/80 - (51%) Gaps:5/80 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 SVGSEDESEDDAEPSVQLKRKQRRSRTTFSNDQIDALERIFARTQYPDVYTREELAQSTGLTEAR 228
            |.||...:|:|......:.||::     .:::|::.||..|......:...:|::|...||...:
plant    52 SKGSSATNEEDVAEIGGMLRKRK-----LTDEQVNMLEYSFGNEHKLESGRKEKIAGELGLDPRQ 111

  Fly   229 VQVWFSNRRARLRKQ 243
            |.|||.|||||.:.:
plant   112 VAVWFQNRRARWKNK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645
Homeodomain 186..242 CDD:459649 17/55 (31%)
HB53NP_201471.1 Homeodomain 71..125 CDD:459649 19/58 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.