DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and HB52

DIOPT Version :9

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_200209.1 Gene:HB52 / 835481 AraportID:AT5G53980 Length:156 Species:Arabidopsis thaliana


Alignment Length:64 Identity:21/64 - (32%)
Similarity:35/64 - (54%) Gaps:2/64 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 QLKRKQRRSRTTFSNDQIDALERIFARTQYPDVYTREELAQSTGLTEARVQVWFSNRRARLRKQ 243
            |.:.|.::.|.|  .||:..||:.|...:..:...:.:|:...||.:.:|.|||.|:|||.:.|
plant     5 QSQGKNKKKRLT--QDQVRQLEKCFTMNKKLEPDLKLQLSNQLGLPQRQVAVWFQNKRARFKTQ 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645
homeodomain 186..243 CDD:238039 18/56 (32%)
HB52NP_200209.1 Homeobox 11..64 CDD:395001 18/54 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.