DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and HDG7

DIOPT Version :10

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001332093.1 Gene:HDG7 / 835293 AraportID:AT5G52170 Length:687 Species:Arabidopsis thaliana


Alignment Length:107 Identity:29/107 - (27%)
Similarity:50/107 - (46%) Gaps:20/107 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 SGSGTSHSIDGILGGGAGSVGSEDESEDDAEPSVQLKRKQRRSR----TTFSNDQIDALERIFAR 206
            |.|.:..|.|.:.|         ||.:.:..|    |:|:|:::    |::   ||..||..|..
plant    30 SRSLSDDSFDAMSG---------DEDKQEQRP----KKKKRKTKYHRHTSY---QIQELESFFKE 78

  Fly   207 TQYPDVYTREELAQSTGLTEARVQVWFSNRRARLRKQLNTQQ 248
            ..:|:...|.||.:...|...:::.||.|||.:::.||...:
plant    79 CPHPNEKQRLELGKKLTLESKQIKFWFQNRRTQMKTQLERHE 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645
Homeodomain 186..242 CDD:459649 17/59 (29%)
HDG7NP_001332093.1 Homeodomain 61..113 CDD:459649 16/54 (30%)
START_ArGLABRA2_like 220..425 CDD:176884
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.