DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and Rhox13

DIOPT Version :10

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001395833.1 Gene:Rhox13 / 691244 RGDID:1586264 Length:234 Species:Rattus norvegicus


Alignment Length:142 Identity:41/142 - (28%)
Similarity:60/142 - (42%) Gaps:56/142 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 SGSGTSHSIDGILGGGAGSVGSEDESEDD----------------------------------AE 176
            |.|.|..|.|           .||:.||:                                  |.
  Rat    77 SESDTEESYD-----------DEDDDEDEGDEDDLSTSDQDTSDPEQEEAALFVAAAAPPIAPAA 130

  Fly   177 PSVQL-------KRKQRRSRTT----FSNDQIDALERIFARTQYPDVYTREELAQSTGLTEARVQ 230
            .::|:       :|:.||.|.:    |:..|::.:|.:|..|.||||.||.|||::..:.|.:|:
  Rat   131 AAIQIPGPHRSRRRRHRRHRRSSPYLFTQWQVEEMENLFEETPYPDVLTRGELARTLNVPEVKVK 195

  Fly   231 VWFSNRRARLRK 242
            ||||||||:.||
  Rat   196 VWFSNRRAKQRK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645
Homeodomain 186..242 CDD:459649 27/59 (46%)
Rhox13NP_001395833.1 Homeodomain 157..207 CDD:459649 24/49 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.