DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and mxtx2

DIOPT Version :9

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001073284.1 Gene:mxtx2 / 58078 ZFINID:ZDB-GENE-000710-6 Length:296 Species:Danio rerio


Alignment Length:243 Identity:68/243 - (27%)
Similarity:97/243 - (39%) Gaps:59/243 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 RRSRTTFSNDQIDALERIFARTQYPDVYTREELAQSTGLTEARVQVWFSNRRARLRKQLNTQQVP 250
            ||.||:|:.:.::.|:..|....||.:..||.|:|:|||.|:|:||||.|:|||..|....|..|
Zfish    23 RRKRTSFTKEHLELLKMAFNVDPYPGISVRESLSQATGLPESRIQVWFQNKRARTLKNRAIQSSP 87

  Fly   251 SFAPTSTSFGATPTTSAAPAPNMGMSLYSSQSWPSSGAYENHAAYGGSVASMSPASSTSGTSSAA 315
            .....|      |..|....|:|                          ||:..::...|..   
Zfish    88 QLDNKS------PLPSPFLPPHM--------------------------ASVGVSAQQRGIQ--- 117

  Fly   316 HSPVQTQAQQPGTGSEFMTSTYGVGSSNATYPSAAYSMPQTPATSAEQLRSQFASAAASGSHHPS 380
            .||...|..|             ....:.|:|.:.||   ||.....|.| ...:::.|.|...:
Zfish   118 ESPFNIQMSQ-------------TSPQHFTFPPSDYS---TPVVKPRQTR-LMGTSSCSPSDLQA 165

  Fly   381 TWDSYNFAGSF-FPPAS---AAGNHISGYHHQVDQKSSMMTTAPTYPY 424
            |.||:::|||. ..|.|   ||.|..:.|.   |:....:...|.|||
Zfish   166 TPDSWSYAGSTQISPESWDVAAENFGNSYK---DESPFFLYPPPPYPY 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645
homeodomain 186..243 CDD:238039 26/56 (46%)
mxtx2NP_001073284.1 HOX 22..76 CDD:197696 24/52 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.