DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and hesx1

DIOPT Version :10

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001016712.1 Gene:hesx1 / 549466 XenbaseID:XB-GENE-483193 Length:186 Species:Xenopus tropicalis


Alignment Length:112 Identity:39/112 - (34%)
Similarity:53/112 - (47%) Gaps:20/112 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LRGSSGSGTSHSIDGILGGGAGSVGSEDESEDDAEPSVQLKR-----KQRRSRTTFSNDQIDALE 201
            ||.|.|..|...::...|            |:|   .:..||     :.||.||.|:..||:.||
 Frog    76 LRRSMGEETQVRLEKCCG------------EED---RLTYKRELSWYRGRRPRTAFTRSQIEILE 125

  Fly   202 RIFARTQYPDVYTREELAQSTGLTEARVQVWFSNRRARLRKQLNTQQ 248
            .:|....||.:..|||||....|.|.|:|:||.||||:|::.....|
 Frog   126 NVFRVNSYPGIDIREELAGKLALDEDRIQIWFQNRRAKLKRSHRESQ 172

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity