DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and PAX7

DIOPT Version :9

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_002575.1 Gene:PAX7 / 5081 HGNCID:8621 Length:520 Species:Homo sapiens


Alignment Length:476 Identity:210/476 - (44%)
Similarity:262/476 - (55%) Gaps:86/476 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GYPFQ-----GQGRVNQLGGVFINGRPLPNHIRRQIVEMAAAGVRPCVISRQLRVSHGCVSKILN 73
            |:|.:     |||||||||||||||||||||||.:|||||..|:||||||||||||||||||||.
Human    24 GFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILC 88

  Fly    74 RFQETGSIRPGVIGGSKPR-VATPDIESRIEELKQSQPGIFSWEIRAKLIEAGVCDKQNAPS--V 135
            |:|||||||||.||||||| |||||:|.:|||.|:..||:||||||.:|::.|.||:...||  |
Human    89 RYQETGSIRPGAIGGSKPRQVATPDVEKKIEEYKRENPGMFSWEIRDRLLKDGHCDRSTVPSGLV 153

  Fly   136 SSISRLLRGSSG----------------SGTSHSIDGILGGGAGSVGSEDESED-DAEPSVQLKR 183
            |||||:||...|                ....||||||||.....:   ||..| ::||.:.|||
Human   154 SSISRVLRIKFGKKEEEDEADKKEDDGEKKAKHSIDGILGDKGNRL---DEGSDVESEPDLPLKR 215

  Fly   184 KQRRSRTTFSNDQIDALERIFARTQYPDVYTREELAQSTGLTEARVQVWFSNRRARLRKQLNTQQ 248
            |||||||||:.:|::.||:.|.||.|||:||||||||.|.||||||||||||||||.|||....|
Human   216 KQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQRTKLTEARVQVWFSNRRARWRKQAGANQ 280

  Fly   249 ----------------VPSFAPTSTSFGATPTTSAAPAPNMGMSLYSSQSWPSSGAYENHAAYGG 297
                            :|:..|........|||:.  :.:.|.:::..|..|.|..::      |
Human   281 LAAFNHLLPGGFPPTGMPTLPPYQLPDSTYPTTTI--SQDGGSTVHRPQPLPPSTMHQ------G 337

  Fly   298 SVASMSPASSTSGTSSAAH--SPVQTQAQQPGTGSEFMT-----------STYGVGSSNATYPSA 349
            .:|:.:.|:.||....|.|  |........|...|..|.           |..|..|:....|.|
Human   338 GLAAAAAAADTSSAYGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQA 402

  Fly   350 AYSMPQTP-------ATSAEQLRSQFASAAASGSHHPSTWDSYNFAGSFFPPA-SAAG---NHIS 403
            .:|:  :|       |||.....||.|.:...|       ||...:.::.||. |..|   :.::
Human   403 DFSI--SPLHGGLDSATSISASCSQRADSIKPG-------DSLPTSQAYCPPTYSTTGYSVDPVA 458

  Fly   404 GYHH-QVDQKSSMMTTAPTYP 423
            ||.: |..|...::..|...|
Human   459 GYQYGQYGQSECLVPWASPVP 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645 96/126 (76%)
homeodomain 186..243 CDD:238039 42/56 (75%)
PAX7NP_002575.1 paired box domain 34..164 98/129 (76%)
PAX 34..163 CDD:238076 98/128 (77%)
octapeptide 86..93 4/6 (67%)
paired homeodomain 217..275 43/57 (75%)
Homeobox 220..273 CDD:278475 39/52 (75%)
Pax7 347..385 CDD:289156 8/37 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..409 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 209 1.000 Domainoid score I2843
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1126858at2759
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - mtm8597
orthoMCL 1 0.900 - - OOG6_105365
Panther 1 1.100 - - LDO PTHR45636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1205
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.