DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and DUXA

DIOPT Version :10

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001012747.1 Gene:DUXA / 503835 HGNCID:32179 Length:204 Species:Homo sapiens


Alignment Length:86 Identity:36/86 - (41%)
Similarity:55/86 - (63%) Gaps:3/86 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 SEDESEDDAEPSVQLK-RKQRRSRTTFSNDQIDALERIFARTQYPDVYTREELAQSTGLTEARVQ 230
            |:.:.:|  :|.|:.: |:.||.|||:|..|:..|.:.|.:..||.:.:|||||:..|:.|:|||
Human    84 SQSQGQD--QPGVEFQSREARRCRTTYSASQLHTLIKAFMKNPYPGIDSREELAKEIGVPESRVQ 146

  Fly   231 VWFSNRRARLRKQLNTQQVPS 251
            :||.|||:||..|...:.|.|
Human   147 IWFQNRRSRLLLQRKREPVAS 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645
Homeodomain 186..242 CDD:459649 28/55 (51%)
DUXANP_001012747.1 homeodomain 16..74 CDD:238039
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..101 5/18 (28%)
Homeodomain 102..155 CDD:459649 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..204 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.