DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and Ptx1

DIOPT Version :9

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster


Alignment Length:303 Identity:87/303 - (28%)
Similarity:127/303 - (41%) Gaps:51/303 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 SVSSISRLLRGSSGSGTSHSIDGILGGGAGSVG-SEDESEDDAEPSVQLKRK-QRRSRTTFSNDQ 196
            |.||||...|.......|.:...|......|.| .|..:....||....|.| |||.||.|::.|
  Fly   211 STSSISNRSRDRKDGNRSVNETTIKTENISSSGHDEPMTTSGEEPKNDKKNKRQRRQRTHFTSQQ 275

  Fly   197 IDALERIFARTQYPDVYTREELAQSTGLTEARVQVWFSNRRARLRKQ-----------------L 244
            :..||..|:|.:|||:.||||:|..|.||||||:|||.||||:.||:                 .
  Fly   276 LQELEHTFSRNRYPDMSTREEIAMWTNLTEARVRVWFKNRRAKWRKRERNAMNAAVAAADFKSGF 340

  Fly   245 NTQQVPSFAPTSTSFGATPTTSAAPAPN-MGMSLYSSQSWPSSGAYENHAAYGGSVASMSPASS- 307
            .||.:..||..|. :.:.|..:....|: :|...:   .||.:       ..|..||.....:| 
  Fly   341 GTQFMQPFADDSL-YSSYPYNNWTKVPSPLGTKPF---PWPVN-------PLGSMVAGNHHQNSV 394

  Fly   308 ---TSGTSSAAHSPVQTQAQQPGTGSEFMTSTYGVGSSNATYPSAAYSMPQTP---ATSAE---- 362
               .:|.|..|.| :...:..||:....:::|..||:..|..|   |:.|..|   .::||    
  Fly   395 NCFNTGASGVAVS-MNNASMLPGSMGSSLSNTSNVGAVGAPCP---YTTPANPYMYRSAAEPCMS 455

  Fly   363 -QLRSQFASAAASGSHHPSTWDSYNFAGSFFPPASAAGNHISG 404
             .:.|..|:.......|.|.    .|...:..|:..:.::.:|
  Fly   456 SSMSSSIATLRLKAKQHASA----GFGSPYSAPSPVSRSNSAG 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645 5/8 (63%)
homeodomain 186..243 CDD:238039 33/56 (59%)
Ptx1NP_001138130.2 Homeobox 268..320 CDD:278475 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450929
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.