DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and Poxm

DIOPT Version :9

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster


Alignment Length:404 Identity:144/404 - (35%)
Similarity:189/404 - (46%) Gaps:49/404 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GRVNQLGGVFINGRPLPNHIRRQIVEMAAAGVRPCVISRQLRVSHGCVSKILNRFQETGSIRPGV 85
            |.||||||||:|||||||..|.:|||:|..|:|||.||||||||||||||||.|:.|||||.||.
  Fly    11 GEVNQLGGVFVNGRPLPNATRMRIVELARLGIRPCDISRQLRVSHGCVSKILARYHETGSILPGA 75

  Fly    86 IGGSKPRVATPDIESRIEELKQSQPGIFSWEIRAKLIEAGVCDKQNAPSVSSISRLLRGSSGS-G 149
            ||||||||.||.:.:.|.||||..||||:||||.:|:..|:|||.|.||||||||:||...|| |
  Fly    76 IGGSKPRVTTPKVVNYIRELKQRDPGIFAWEIRDRLLSEGICDKTNVPSVSSISRILRNKLGSLG 140

  Fly   150 TSHSIDGILGGGAGSVGSEDESEDDAEPSVQLKRKQRRSRTTFSNDQIDALERIFARTQYPDVYT 214
            ..|:...::|.|:.|.|.          ||.....|....:..:|..:..|........:|..:.
  Fly   141 HQHTPGTVMGSGSSSGGG----------SVSSNGGQNNGTSASNNINLSNLGNPGGGPHHPHHHH 195

  Fly   215 REELAQSTGLTEARVQVWFSNRRARLRKQL-NTQQVPSFAPTSTSFGATPTTSAAPAPNMGMSLY 278
            ..:.|      .|.......:..|.....| |:...|..|..:.|.   .|...:|:|..|....
  Fly   196 HHQSA------AAAASAHHVHAHAHAHAHLYNSIYQPYSAAAAYSM---KTPCGSPSPPQGAGGQ 251

  Fly   279 SSQSWPSSGAYENHAAYGGSVASMSPASSTSGTSSAAHSPVQTQAQ-QPGTGSEFMTSTYGVGSS 342
            .|...|    ::..:....:.|:..|:|.:.....|.|..|..:|. |.|.|      ..|:|..
  Fly   252 GSVPHP----HQLRSVAAAAAAAHWPSSHSVSDILAHHQAVALRASCQVGVG------VGGMGGM 306

  Fly   343 NATYPSAAYSMPQTPATSAEQLRSQFASAAASGSHHPSTWDSYNFAGSFFPPASAAGNHISGYHH 407
            .:|    ...:|.||:..|.....|.......|:...|.::.|.:..:       .|.|   :||
  Fly   307 GST----VSPLPMTPSPVAGTAGGQPLLDCEGGAGQQSPYNYYMYFQN-------GGMH---HHH 357

  Fly   408 QVDQKSSMMTTAPT 421
               ....||....|
  Fly   358 ---HHGGMMAAGAT 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645 86/121 (71%)
homeodomain 186..243 CDD:238039 6/56 (11%)
PoxmNP_001036687.1 PAX 10..133 CDD:128645 86/121 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450881
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.