DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and eve

DIOPT Version :9

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:313 Identity:82/313 - (26%)
Similarity:117/313 - (37%) Gaps:81/313 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 SIDGILGGGAGSVGSEDESEDDAEPSVQLKRKQRRSRTTFSNDQIDALERIFARTQYPDVYTREE 217
            |.|..|.|..|       ||..|:|||      ||.||.|:.||:..||:.|.:..|.....|.|
  Fly    51 SPDNSLNGSRG-------SEIPADPSV------RRYRTAFTRDQLGRLEKEFYKENYVSRPRRCE 102

  Fly   218 LAQSTGLTEARVQVWFSNRRARLRKQLNTQQVPSFAPTS-TSFGATPTTSAAPAPNMGMSLYSSQ 281
            ||....|.|:.::|||.|||.:.::|......|..|..| .:|.|:...:||.:..|....|:  
  Fly   103 LAAQLNLPESTIKVWFQNRRMKDKRQRIAVAWPYAAVYSDPAFAASILQAAANSVGMPYPPYA-- 165

  Fly   282 SWPSSGAYENHAAYGGSVASMSPASSTSGTSSAAHSPVQTQAQQPG-TGSEFMTSTYGVGSSNAT 345
              |::.|    ||...:..:.:|..:|.  ......|.....|.|| :|.....|.||      .
  Fly   166 --PAAAA----AAAAAAAVATNPMMATG--MPPMGMPQMPTMQMPGHSGHAGHPSPYG------Q 216

  Fly   346 YPSAAYSMPQTPATSAEQLRSQFASAAASGSHHP------STWDSYNFAGSF------------- 391
            |....|.:|..||.         ...|....|||      :|..||: ||:.             
  Fly   217 YRYTPYHIPARPAP---------PHPAGPHMHHPHMMGSSATGSSYS-AGAAGLLGALPSATCYT 271

  Fly   392 ----------FPP---ASAAGNH--------ISGYHHQVDQKSSMMTTAPTYP 423
                      .||   .|::..|        :...|.:|..:|.:..:||:.|
  Fly   272 GLGVGVPKTQTPPLDLQSSSSPHSSTLSLSPVGSDHAKVFDRSPVAQSAPSVP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645
homeodomain 186..243 CDD:238039 23/56 (41%)
eveNP_523670.2 Homeobox 74..126 CDD:278475 21/51 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450991
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.